PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000373350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 127aa    MW: 14337.3 Da    PI: 9.8513
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000373350genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP739.5e-2364121259
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpai 59 
                     g+kdrhsk++T +g+ dR vRls+++a++++dLq++LG+ ++sk ++WLl +   ++
  MDP0000373350  64 FGGKDRHSKVCTIRGLQDRQVRLSVPTAIQLYDLQERLGLNQPSKVVDWLLDDDHNQV 121
                    689************************************************9866655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.5E-2166124IPR005333Transcription factor, TCP
PROSITE profilePS5136922.11666124IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGVERYYQLA KNPTTIGCRK LENGLPEGGE EHQKYSGGRL WSSTTPRECP RLKDPRIVRA  60
SRAFGGKDRH SKVCTIRGLQ DRQVRLSVPT AIQLYDLQER LGLNQPSKVV DWLLDDDHNQ  120
VRLLPG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163248e-91fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010677e-45KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348175.12e-78PREDICTED: transcription factor TCP13-like
SwissprotQ9S7W54e-35TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A022RZ065e-38A0A022RZ06_ERYGU; Uncharacterized protein
STRINGSolyc02g089020.1.16e-37(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.19e-37plastid transcription factor 1